PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.7NG272700.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family MYB
Protein Properties Length: 347aa    MW: 37016 Da    PI: 8.3898
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.7NG272700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding34.64.4e-113176146
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
      Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                         +g+W +eEd  l++ v+ +G+++W++I ++  + Rt+k+c++rw +
  Pavir.7NG272700.1.p 31 KGPWMAEEDAVLLEHVRAHGPRDWSSIRSKGLLPRTGKSCRLRWVN 76
                         79*************************8876677**********87 PP

2Myb_DNA-binding42.51.5e-1387127345
                          SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
      Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                          ++++eE+   +++ +q+G++ W++Ia +++ gRt++++k++w 
  Pavir.7NG272700.1.p  87 KFSAEEERVVLELQAQFGNK-WARIATYLP-GRTDNDVKNFWS 127
                          79******************.*********.***********5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.0552678IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.2E-182879IPR009057Homeodomain-like
SuperFamilySSF466892.97E-2629126IPR009057Homeodomain-like
SMARTSM007171.1E-93080IPR001005SANT/Myb domain
CDDcd001672.12E-103378No hitNo description
PfamPF139214.1E-103484No hitNo description
PROSITE profilePS5129420.25279134IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.2E-1880132IPR009057Homeodomain-like
SMARTSM007175.2E-1284132IPR001005SANT/Myb domain
PfamPF002498.5E-1287127IPR001005SANT/Myb domain
CDDcd001671.50E-1087126No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048235Biological Processpollen sperm cell differentiation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 347 aa     Download sequence    Send to blast
MARAPGGGRR RGGGGGGRKR DAAGGGEAVR KGPWMAEEDA VLLEHVRAHG PRDWSSIRSK  60
GLLPRTGKSC RLRWVNKLRP NLKTGCKFSA EEERVVLELQ AQFGNKWARI ATYLPGRTDN  120
DVKNFWSTRQ KRLARLLRAP LPARCTSRNT GAAGKAPAAA SSLESRPATV GPCLDRVPFG  180
SSSSGVHPCS AATPFMDARN AALVPYDQSA SGLLSFNGAL PPFAPGIDSQ ECSSSNAAPL  240
LQQSPFDEPP YPLLDYPGMP ECWNMAPGGF VNAGTMDYLA YQELLPMIAQ SAPMMFPFFG  300
TECAQGGVKP EPPDAPDFFD DLPPDMFDSL DQVPPPLSPP ATSSGF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-263113227126MYB TRANSFORMING PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1614GGRRRGGGG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAL6630004e-55AL663000.4 Oryza sativa genomic DNA, chromosome 4, BAC clone: OSJNBb0034G17, complete sequence.
GenBankAL7316134e-55AL731613.5 Oryza sativa genomic DNA, chromosome 4, BAC clone: OSJNBa0065H10, complete sequence.
GenBankAP0149604e-55AP014960.1 Oryza sativa Japonica Group DNA, chromosome 4, cultivar: Nipponbare, complete sequence.
GenBankCP0126124e-55CP012612.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 4 sequence.
GenBankCR8552184e-55CR855218.1 Oryza sativa genomic DNA, chromosome 4, BAC clone: OSIGBa0106P14, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004978165.10.0PREDICTED: myb-related protein MYBAS2
TrEMBLK3YCT20.0K3YCT2_SETIT; Uncharacterized protein
STRINGSi012032m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP57003357
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60460.15e-62MYB family protein